TIGIT His Tag Protein, Cynomolgus
SKU: 19464940905

TIGIT His Tag Protein, Cynomolgus

Sale price$202.50 Regular price$225.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TIGIT His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Amino Acid Sequence Met22 Pro142, with C terminal 6*His MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIPGGGSGGGSHHHHHH Expression System HEK293 Molecular Weight 20 30kDa (Reducing) Purity >90% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Cynomolgus
Amino Acid Sequence Met22-Pro142, with C-terminal 6*His MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIPGGGSGGGSHHHHHH
Expression System HEK293
Molecular Weight 20-30kDa (Reducing)
Purity

>90% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

T-cell immunoreceptor with Ig and ITIM domains (TIGIT), also known as VSIG9, VSTM3, and WUCAM, is a member of the poliovirus receptor family of immunoglobulin proteins. TIGIT is expressed at low levels on subsets of T cells and NK cells, and is upregulated at the protein level following activation of these cells. TIGIT marks exhausted T cells in the tumor microenvironment and during human immunodeficiency virus (HIV) infection. Research has shown TIGIT interacts with several receptors expressed on antigen presenting cells, such as dendritic cells and macrophages, as well as tumor cells and cells of the microenvironment. TIGIT binds with high affinity to PVR/CD155, and with low affinity to Nectin-2/CD112 and Nectin-3/CD113. Upon binding to its ligands, TIGIT suppresses T cell activation, and inhibits T and NK cell cytotoxicity. This inhibition can be blocked using monoclonal antibodies directed at the extracellular domain of TIGIT, resulting in rejuvenated antigen-specific CD8+ T cell responses in tumors and during HIV infection. Three potential isoforms of TIGIT have been computationally mapped.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 19464940905

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 1054 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
S. Kirby
Alexandria, US
★★★★★ 4
Decent at dampening sound
Color: Grey, Color: Grey
This partition was easy to assemble and is stable. My husband and I both work from home, and the desire was to have a sound barrier. It definitely dampens the noise. If it was another foot taller, that would be even better at dampening the noise. Obviously, we still hear one another quite well, but the partition simply softens the noise of each other.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
T
Verified Purchase
Thanh Lam
Alexandria, US
★★★★★ 5
CEO
Color: Grey
Work perfect
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
K
K
Port Orchard, US
★★★★★ 5
Easy Install, Great Quality, Mobile Partition
Color: Grey
This is the easiest install I've ever had in my life, took about 5 minutes. These panels come pre-assembled, minus the wheels, which screw into the base pieces in pairs. The material is a very pleasant "corporate grey" - I only worry about its color fastness over time. I needed a practical solution for my garage, which has glass garage doors that let in a ton of sun/heat and even with privacy film still parade around my tools and belongings visibly to anyone walking by. These partitions are functional for both of my needs, and if I have a visitor needing to park in my second spot it takes 5 seconds to wheel these out of the way.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2026
A
Amazon customer
Houston, US
★★★★★ 5
Nice, convenient partition that absorbs sound
Color: Grey, Color: Grey
What stood out * Instant partition: This 3-panel foldable office partition helps to create quiet zones in a shared room, and it genuinely helped carve out a more focused space without a major renovation. The panels feel substantial yet easy to move thanks to the wheels, so I can roll them into position when I need privacy or a professional background for video meetings. I can fold them flat against a wall when I don’t nee them. The aluminum frame gives it enough rigidity to stay upright, and the gray finish is neutral. The height and width are generous for desktop setups, meetings, or study areas, and because it’s modular you can arrange it in L-shapes, straight lines, or even semi-circles. The mobility makes it flexible for dynamic spaces — roll it out for working hours, tuck it away after. * Sound insulation: It's heavy, which is better for sound isolation. The sound-dampening design isn’t miracle acoustic treatment, but it noticeably softens background chatter and echoes — enough to make video calls and focused work feel less disrupted. * Assembly is super easy, but I would recommend to have two people to make it easier. What to keep in mind * It’s not sound-proof like a built-in wall, so loud noises still carry; it’s best for softening ambient sounds, not blocking them completely. * The gray color is neutral, but if your room palette is bold you might want to accent with décor so it doesn’t look utilitarian. You can also tack posters and light pictures to the the gray frames. * It's pricey, but worth it in my opinion.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 19, 2026
O
Off The Grid Ken
Dallas, US
★★★★★ 4
Decent dividers
Color: Grey
I think you will love these under the right circumstances. Number one the sound absorption is hard to describe because since the panels don't go to the roof sound can easily travel to the other so you and without being hindering but they do absorb sound to a certain extent. They also provide pretty good coverage for privacy in an office or dorm situation with ease. I wouldn't say it's easy to store but it does fold up pretty well and overall for the price it's an effective means of letting those around you know you need some peace. For the price it's a pretty good divider. It requires very little assembly and is relatively sturdy so all in all not a bad option. Until We Meet Again -Off The Grid Ken
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2026

recommand products