LILRA6/CD85b/ILT8 His Tag Protein, Human
SKU: 5474893088

LILRA6/CD85b/ILT8 His Tag Protein, Human

Sale price$324.00 Regular price$360.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRA6/CD85b/ILT8 His Tag Protein, HumanProduct Specification Species Human Accession Q6PI73 1 Amino Acid Sequence Gly24 Asn447, with C terminal 8*His

Product Specification


Species Human
Accession Q6PI73-1
Amino Acid Sequence Gly24-Asn447, with C-terminal 8*His GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVENGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 60-7 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

LILRA6, Leukocyte Immunoglobulin-like Receptor subfamily A, member 6, also called CD85b and ILT8.The leukocyte immunoglobulin-like receptor (LILR) multigene family is a family of paired receptors composed of inhibitory and activating forms, which are highly homologous in their extracellular regions and different in their intracellular regions. LILRA6 is the activating forms, which have two or four Ig-like domains with short cytoplasmic tail and associate with FcRγ chain containing immunoreceptor tyrosine-based activation motifs. LILRA6 (ILT8/CD85b) and LILRB3 (ILT5/CD85a) are paired receptors expressed by myelomonocytic leukocytes. LILRA6 and LILRB3 have high similarity in their extracellular domain, making them further difficult to distinguish., and mAbs generated against these receptors bind to neutrophils. In addition, LILRA6 is correlated with susceptibility to atopic dermatitis. LILRA6 on the surface of macrophages induces and regulates cytokines such as IL-4, IL-10, IL-17, TNFα and IFN-γ.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 5474893088

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 1122 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Los Angeles, US
★★★★★ 5
Very well made chew bone!
Color: 1 PC-Beef-Red
Great durable, very well made chew bone! Our dog usually tears up all his toys within a few minutes or sometimes hours after he gets them. He’s had this bone for a few days and it’s still in one piece. Except for the rubber that’s in the middle, he chewed up in a couple of days. I would definitely buy more chew toys made by this company! Well worth the money!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
P
Verified Purchase
Pittieluv79
Grantham, US
★★★★★ 3
The rubber middle is not durable, it lasted less than 3 hours.
Color: 1 PC-Beef-Red
I bought this as I have bully/husky puppies (9 months old) and a pitt/doberman (9 years old). They are heavy chewers and destroy everything. I saw a video of this toy. The woman said that her dog chewed on it for a while (about 2 hours or so) she showed the ends visibly chewed, which I expect but it was holding up. The rubber middle seemed to hold up to. I received this yesterday. I had to take it away from them last night as they were chewing the rubber middle off. They had it maybe 3 hours. I didn't give it a lower star score as I will just cut the rubber off and give it back to them. So I was disappointed in the rubber middle not being more durable but the hard plastic it's made from is the strong material they need.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
B
Verified Purchase
BLACKHAWKS
Houston, US
★★★★★ 5
Bones
Color: 1 PC-Beef-Red
Yes bone 🍖 is very strong and durable MIA, Rocky and Rambo love them ..
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
L
Verified Purchase
Lexi
Phoenix, US
★★★★★ 4
Smaller than pictured but still a good choice for LG-XL dogs/power chewers!
Color: 3 PC-Beef-Red, Color: 3 PC-Beef-Red
Fantastic that these come in a 3 pack - I wish more chew toys did this! The base for these chew toys is pretty tough! The center & ends are hard enough to withstand both my bully mixes & my Irish wolfhound/Great Dane cross. They’re safe enough for even the largest power chewers! (With Supervision) my American Bully got the rubber spikes chewed off in under 20 minutes which is mildly disappointing but he’s a true powerhouse & master destroyer of all chews so I’m not that bent out of shape about it. I do wish they were as large as they appear in the ad pics but isn’t that the game we all play ordering offline anymore? 🤷🏻‍♀️ • Pro Tip: smear this toy in peanut butter (xylitol free!), wet food mixed into a slurry with water or bone broth + kibble/treats, yogurt, or even pumpkin puree and freeze for a few hours & relax while watching all the organic engagement your dog gets out of this toy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
L
Verified Purchase
Lizbeth
Cuba, US
★★★★★ 5
Nice variety and won’t fall apart
Style: 8 - Pack Frog
Great for my puppy to play with, gives a good variety of options and is sturdy enough to not fall apart
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026

recommand products