
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 8 - Jul 13
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP1 His Tag Protein, HumanProduct Specification Species Human Synonyms LFABP Accession P07148 Amino Acid Sequence Met1 Ile127, with N terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAG E& RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage
Product Specification
| Species | Human |
| Synonyms | LFABP |
| Accession | P07148 |
| Amino Acid Sequence | Met1-Ile127, with N-terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI |
| Expression System | E.coli |
| Molecular Weight | 16kDa (Reducing) |
| Purity | >95% by SDS-PAG E& RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
FABP1 (LFABP) has been initially characterised in the liver (thus its name) but is also expressed in small intestine (duodenum and jejunum). FABP1 appears to be the most promiscuous FABP as it was reported to bind a variety of small molecules in addition to fatty acids including bile acids, lysophosphatidic acid, prostaglandins, fatty acyl-CoA, bilirubin and heme. FABP1 is a PPARα target gene. While some studies suggested that FABP1 might be involved in the delivery of ligands for PPARα activation in the nucleus, FABP1-deficient mice showed normal regulation of PPARα target genes regulation. FABP1 was reported to enhance apoB-lipoprotein secretion, which would suggest involvement of this protein in the delivery of fatty acids to the ER for esterification into lipoprotein-destined TG. Hepatic fatty acid oxidation is also diminished in fasted FABP1 knockout mice, which implies deficient transport of fatty acids to the oxidative pathway. Interestingly, no accumulation of intracellular TG accompanied attenuation of fatty acid oxidation even when the mice were challenged with a high-fat diet.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.3 ★★★★★
Based on 547 reviews
Sort
Product Reviews
★★★★★ 5
Wonderful
Style: Kids SPF 50, Size: 3 Fl Oz (Pack of 1)
I love it! My daughters have very delicate skin and this product works wonders.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 27, 2025
★★★★★ 5
I hate sunscreens, but...
Style: Kids SPF 50, Size: 3 Fl Oz (Pack of 1)
I hate sunscreen in general--for it's texture and smell. But, being the palest family on Earth makes it a daily necessity. I was pleasantly surprised to actually like the smell of this product! It's a light fruity fragrance. It has a smooth texture like lotion and glided on my skin without being too thick or greasy and no white marks. A little goes a long way too! I could hardly believe I was putting on sunscreen and not regular body lotion. My kids had no issue with it either! They let me put this stuff on their little faces without complaint since it goes on so smoothly. Most importantly, this product did it's job and we were sunburn free. The tube is small--4 ounces--but I don't care because it's so worth having something that goes on easy and doesn't make us greasy and stinky. I bought several tubes--one for each member of the family.
*If this review was helpful, please click 'yes' below. Thanks!*
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 14, 2018
★★★★★ 4
It’s ok
Style: Kids SPF 50, Size: 3 Fl Oz (Pack of 1)
Doesn’t smell like anything, especially not fruit. Seems to work well- it’s what we use on our faces. I started using this all over on my daughter because their spray version is not good.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2019
★★★★★ 5
Overall this is a very good product
Style: Kids SPF 50, Size: 3 Fl Oz (Pack of 1)
I bought this because every sunblock I own eventually gets in my eyes and burns the living daylights out of them. I prefer to use something that isn't laden with chemicals, is cruelty free and reef safe so this looked like it would fit the bill and indeed, it does.
It is a true "no tears" formula which I very much appreciate. As with so many zinc based sunblocks there's still a slight "Kabuki mask" effect but it isn't as bad as some of the other zinc products. I wouldn't go so far as to say it's easy to spread because it doesn't have a lot of "slip", doesn't glide like the non-zinc products. You do have to work with it for awhile to get rid of the decidedly chalky consistency but once you get going it seems to be okay. I think somebody else mentioned using a moisturizer before you put it on which seems like good idea even though this is supposed to be moisturizing.
Would I purchase this again? I'm pretty sure I will because the "no tears" aspect of the product is important to me. I'll probably use it with a light carrier oil on my face first, let that oil sink in and then put this on top. I'll keep you posted on how that works out.
Thank you, Alba Botanica, for being cruelty free and reef safe!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 22, 2020
★★★★★ 5
Thank you for making this
Style: Kids SPF 50, Size: 3 Fl Oz (Pack of 1)
I have the most sensitive reactive skin. I regularly will breakout to products that are supposed to be hypoallergenic and non-clogging. I have used this product multiple times and have not had one issue. I also burn in literally 2 mins and I live in Las Vegas. This protected me and my skin did not react. It absorbed in like regularly lotion not leaving any white cast or sticky feeling. There was no scent which is SO important. I wore it only in the sun not swimming so I cannot comment on how well it works under those conditions. I will by this again without hesitation. If you are in need of a high quality sun protector and have skin like a baby or you are a baby this is the best.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026