RENIN (R66K) His Tag Protein, Human
SKU: 60042591362

RENIN (R66K) His Tag Protein, Human

Sale price$362.70 Regular price$403.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

RENIN (R66K) His Tag Protein, HumanProduct Specification Species Human Antigen Renin Synonyms REN, FLJ10761, Renin, angiotensinogenase Accession P00797 Amino Acid Sequence Leu24 Arg406 (R66K), with C terminal 8*His

Product Specification


Species Human
Antigen Renin
Synonyms REN, FLJ10761, Renin, angiotensinogenase
Accession P00797
Amino Acid Sequence

Leu24-Arg406 (R66K), with C-terminal 8*His LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKKLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALARGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 45-50kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Yokosawa, H. et al. (1980) J. Biol. Chem. 255:3498. 2. Fuminaki, S. et al. (2004) in Handbook of Proteolytic Enzymes, Barret, A. J. et al. eds. p. 54.

Background

Human Renin is a member of the aspartyl proteinase family produced largely in part by the juxtaglomerular cells in the kidney. Renin is also known as REN and angiotensinogenase, is a circulating enzyme that participates in the body's renin-angiotensin system (RAS), and plays an essential role in the elevation of arterial blood pressure and increased sodium retention by the kidney. Renin activates the renin-angiotensin system by cleaving angiotensinogen, produced by the liver, to yield angiotensin I, which is further converted into angiotensin II by ACE, the angiotensin-converting enzyme primarily within the capillaries of the lungs. Renin is secreted from kidney cells, which are activated via signaling from the macula densa, which responds to the rate of fluid flow through the distal tubule, by decreases in renal perfusion pressure (through stretch receptors in the vascular wall), and by sympathetic nervous stimulation, mainly through beta-1 receptor activation. Renin can bind to ATP6AP2, which results in a fourfold increase in the conversion of angiotensinogen to angiotensin I over that shown by soluble renin. In addition, renin binding results in phosphorylation of serine and tyrosine residues of ATP6AP2. The level of renin mRNA appears to be modulated by the binding of HADHB, HuR and CP1 to a regulatory region in the 3' UTR. An over-active renin-angiotension system leads to vasoconstriction and retention of sodium and water. These effects lead to hypertension. Therefore, renin inhibitors can be used for the treatment of hypertension. Renin differs from the other members of this class by having a pH optimum near the neutral pH region with native substrates instead of a pH 2.0 to 3.4 range.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 60042591362

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 1845 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Leigh Evans
Omaha, US
★★★★★ 5
Fun for dogs
Color: Green/Alligator, Size: Small
Smaller than I expected, but the two little dogs love it! They love shaking it, making it squeak, tugging it against each other & chasing it when I throw it to fetch. They often sleep laying on it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
A
Verified Purchase
Amy Jo
West Palm Beach, US
★★★★★ 3
Shows wear quickly
Color: Multicolor/Sheep & Cow, Size: Medium
These are cute but not holding up as well as I had hoped. Quality is ok and the Velcro has held up great. The fabric just isn’t as good as it could be. They are much larger than expected.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
A
Verified Purchase
Alice
Boise, US
★★★★★ 5
Best dog toy!
Color: Multicolor/Alligator & Wild Duck, Size: Medium, Color: Multicolor/Alligator & Wild Duck, Size: Medium
Best dog toy! Most dog toys lady maybe a week or less but this one has been going strong for almost 2 months. Both the squeekers still work on both toys i purchased. My vizsla loves ti squeek and carry it around. We added an empty water bottle in the pocket cavity for some extra fun! Yes, we are still on the same water bottle! Fantastic durability.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
V
Verified Purchase
Victor Densmore
Fort Morgan, US
★★★★★ 5
Great cuddle toy!
Color: Bunny (Mauve), Size: Medium, Color: Bunny (Mauve), Size: Medium
My Lolli loved this bunny. Just the right size for her to cuddle with. It’s soft and cute with just enough crinkle noise to keep her interested. Loved the color!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
M
Verified Purchase
MuchosPoptartos
Pawtucket, US
★★★★★ 5
Best toy for Fetch, Inside and outside. I have multiple of them!
Color: Colors May Vary, Size: 5.5 Inch
Size: LARGE This is hands-down my favorite toy for playing fetch/exercising my dog. I've already bought 2 of these, and I am buying a third because the first one is being rotated out (it got baked by the sun after 3 years outside haha). My Story: My dog LOVES to play. All the time. Inside and outside (well duh, all dogs do). But this toy allows me to play inside while not worrying too much about breaking things. My dog has grown out of his "chew to DESTROY it!" phase, so he is able to keep his toys for a long time. I hate touching toys after they've been slobbered all over, it keeps me from playing with him! There are so many toys that become slippery or slimy after just one throw! But THIS is a great toy because you are able to pick it up with one finger, and just fling it really easily, without getting your hands all gross. In fact, when i'm playing outside with my dog, I actually KICK these (large or jumbo size only) instead of throwing them. They are perfect for that! and I can get a good kick and consistent placement every time with this thing. And then, I don't have to touch it with my hands AT ALL! Reasons I love it: - Non-destructive Indoor Play: I like that this thing keeps its shape, but when it hits things, it just doinks off really lightly and doesn't cause any marks or damage to walls, windows, etc. Note: my house is also not full of knick-knacks or delicate items placed all around that are in harm's way. I'm sure it could knock down some little glass vases if it made contact. The point is, if you place your throws well, you are very unlikely to damage anything in your house (besides your wood floors from your dog's nails sliding all around haha). - Quiet: When you kick/throw this toy, and then it lands on the ground/hardwood, it doesn't sound like a bomb went off in your house. It lands softly and lightly, as if you tossed a half-empty toilet paper roll. I have hardwood at my house, so when I play with other toys, they land on the floor and go BOOM as if you just dropped a 20lb weight! If someone else is playing with my dog with other toys and i'm in the other room, it nearly scares the pants off me. I run in and say, "WHAT THE HELL IS GOING ON --oh, you're just playing! so cute. Sorry, continue on." - Slobber-Free: You don't have to touch the slobbery part in order to throw it or kick it to your dog! Very easily kick-able; it's my preferred method of playing fetch (least energy for me, although I should be the one running, ha). - Easy to catch: Super easy for my dog to catch. He should be a wide receiver cuz he catches things that, when I kick it, while it's in the air i'm thinking, "AW CRAP, that's way too far..... OH WAIT, he got it?!?! noiiice!" Makes an amateur "quarterback" proud lol. - Price: It's not $20 per ball! Some toys are $20 and they make you REALLY have to think ... "Does he REALLY need this toy....??" the answer is always NO, (because he has a million toys that are perfectly good). And then I waver so long on the purchase that I forget it even exists! - Longevity: If your dog is past the "MUST.DESTROY.ALL.THINGS!" stage, then it will last a long time. After 3 years, I'm finally replacing/rotating-out the first one I bought 3 years ago. It has been in the sun, rain, winter, mud; everything. I could still use it; it's totally usable! I was just like, "Eh, why not get a new one?" Honestly, you can never have too many of these. seriously. - Light, Easily Portable: I always pack these in my dog bag. They are light, and they can smoosh into the bag to a smaller size if my bag is full. No problem. - Least-annoying toy that your dog brings to you: My dog likes to HINT that he wants to play by bringing his toys and setting them in my lap (wherever i am). With most of his other toys, my reaction is, "GROSS! it's already so slimy!" and I flick it off of me. This Hole-Y Roller is light and not slimy so you can quickly fling it for your dog without getting side-tracked from whatever “unimportant human activity” you’re doing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 12, 2018

recommand products