LAG-3/CD223 His Tag Protein, Mouse
SKU: 66803206743

LAG-3/CD223 His Tag Protein, Mouse

Sale price$115.20 Regular price$128.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LAG-3/CD223 His Tag Protein, MouseProduct Specification Species Mouse Synonyms Lymphocyte activation protein 3 Accession Q61790 Amino Acid Sequence Gly24 Glu422, with C terminal 8*His

Product Specification


Species Mouse
Synonyms Lymphocyte-activation protein 3
Accession Q61790
Amino Acid Sequence

Gly24-Glu422, with C-terminal 8*His GPGKELPVVWAQEGAPVHLPCSLKSPNLDPNFLRRGGVIWQHQPDSGQPTPIPALDLHQGMPSPRQPAPGRYTVLSVAPGGLRSGRQPLHPHVQLEERGLQRGDFSLWLRPALRTDAGEYHATVRLPNRALSCSLRLRVGQASMIASPSGVLKLSDWVLLNCSFSRPDRPVSVHWFQGQNRVPVYNSPRHFLAETFLLLPQVSPLDSGTWGCVLTYRDGFNVSITYNLKVLGLEPVAPLTVYAAEGSRVELPCHLPPGVGTPSLLIAKWTPPGGGPELPVAGKSGNFTLHLEAVGLAQAGTYTCSIHLQGQQLNATVTLAVITVTPKSFGLPGSRGKLLCEVTPASGKERFVWRPLNNLSRSCPGPVLEIQEARLLAERWQCQLYEGQRLLGATVYAAEHHHHHHHH

Expression System HEK293
Molecular Weight

55-60kDa (Reducing)

Purity

>95% by SDS-PAGE&RP-HPLC

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

Lymphocyte-activation protein 3 belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4. The LAG3 is Biased expression in spleen (RPKM 15.1), lymph node (RPKM 8.3) and 12 other tissues. Lymphocyte activation gene 3 (LAG3) is an inhibitory checkpoint protein expressed on activated T effector, T regulatory, and natural killer cells. The main function of LAG3 is the regulation of immune homeostasis. Several studies have suggested its role in malignant and autoimmune diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 66803206743

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 713 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon_Customer
Lowell, US
★★★★★ 5
The "Lazy Professional" Look: Is Hands-Free Luxury Actually Real?
Size: 9.5, Color: Black Napa Leather
Living down here in Florida, my footwear needs are pretty specific. It’s hot, it’s humid, and I spent half my life rushing from the car into work or a meeting. I’ve reached that age where I value efficiency just as much as style—maybe more. I’ve been eyeing the Marc Joseph New York Hands-Free Slip-on Penny Loafers for a while, and after putting them through the wringer, here is the honest truth from someone who just wants to look sharp without the hassle. The "Just Step-In" Reality Look, the big selling point here is the "Hands-Free" tech. We’ve all seen the commercials for those athletic slip-ins, but finding that in a legitimate leather penny loafer is a different game. Does it work? Yes, surprisingly well. The heel counter is firm enough that it doesn’t collapse when you slide your foot in, but it doesn’t feel like a piece of plastic digging into your Achilles once you’re in. For those of us who are tired of bending over or hunting for a shoehorn every morning, this is a genuine quality-of-life upgrade. The Florida Factor: Comfort and Style The leather is actual calfskin (on most models), which is a must for the Florida heat. Synthetic shoes turn into a sauna within ten minutes, but these breathe reasonably well. The aesthetic is classic—it’s a "professor" shoe through and through. You can wear them with chinos and a blazer for work or throw them on with some nice jeans for a weekend lunch. Inside, they’ve got a gel heel insert and a padded footbed. It’s not quite "walking on a cloud"—let’s not over-hype it—but it’s a massive step up from the hard, flat soles of traditional dress loafers. I’ve spent four hours on my feet lecturing, and my arches didn’t hate me by the end of the day. The Sizing Gamble Here’s where you need to be careful. The consensus from other guys (and my own experience) is that the sizing is a bit of a coin toss. They tend to run a little large and sometimes wide. If you have narrow feet, you might find the sides "gaping" or flaring out when you walk, which kills the sleek look. I’d recommend ordering a half-size down if you’re usually between sizes. The Breakdown The Pros: True Hands-Free: You can actually put these on while holding a coffee and a briefcase. No hands needed. Legit Materials: The calf leather feels premium and smells like the real deal. Versatility: Perfectly bridges the gap between a "car shoe" and a formal loafer. Comfort: The gel insert makes a noticeable difference for long-duration wear. The Cons: Sizing Inconsistency: They can run wide, leading to some "heel slip" if you don't get the perfect fit. Break-in Period: The heel is stiff by design (to allow for the slip-on feature), so expect a day or two of minor stiffness. Price Point: They aren't cheap, though often on sale. Value for Money Are they worth it? If you’re comparing them to high-end Italian brands that cost $500, these are an absolute steal. They look 90% as good for a fraction of the price. However, if you're used to $60 mall shoes, the jump to $150+ might feel steep until you realize you’re paying for the convenience of never having to touch your shoes to put them on. For a daily driver in a professional setting, the value is definitely there.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
E
Verified Purchase
Edward A. Cleveland
Louisville, US
★★★★★ 5
Step In Look Good
Size: 11.5, Color: Cognac Napa Leather
I am wearing these shoes as I write this review, and they look and feel great. I have a bit of a disability with drop foot on the right leg and bilateral neuropathy and have been wearing step in shoes for about 10 years. But the first company that introduced leather dress and casual shoes stopped making them and now only makes sport and casual shoes. So I have been searching for some that meet my need for shoes like this and this company has given me three pairs, so far. Easy to get into, comfortable to wear, and good looking. And they take polish very well, too. (Remember how to do that?). We may buy another pair or two in different styles as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
B
Verified Purchase
Book dude
Waukegan, US
★★★★★ 4
Runs tight. Skinny and smaller than other brands.
Size: 8.5, Color: Brown
Comfy and lots of support. Cushiony. Beware: the brown I ordered runs small. Tighter than other brands.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
L
Verified Purchase
Loren
Charlottesville, US
★★★★★ 5
Right Decision
Size: 12 Wide, Color: Cognac Napa Leather
Very comfortable. Classic style.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2026
Y
Verified Purchase
YWC
New York, US
★★★★★ 1
Leather peels right off
Size: 8, Color: Black
Very poor quality - shoes are ruined after a couple months
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026

recommand products