IL1RL1/ST2 (isoform A) His Tag Protein, Human
SKU: 8175398458

IL1RL1/ST2 (isoform A) His Tag Protein, Human

Sale price$207.00 Regular price$230.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL1RL1/ST2 (isoform A) His Tag Protein, HumanProduct Specification Species Human Synonyms IL1RL1, DER4, FIT 1, IL33R, ST2, ST2L, ST2V, T1 Accession Q01638 Amino Acid Sequence Lys19 Ser328, with C terminal 8*His

Product Specification


Species Human
Synonyms IL1RL1, DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1
Accession Q01638
Amino Acid Sequence Lys19-Ser328, with C-terminal 8*His KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHSGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 55-72kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Savenije O E. et al. (2011) Interleukin-1 receptor-like 1 polymorphisms are associated with serum IL1RL1-a, eosinophils, and asthma in childhood. J Allergy Clin Immunol. 127(3): 750-756.

2、Li H. et al. (2000) The cloning and nucleotide sequence of human ST2L cDNA. Genomics. 67(3): 284-290.

Background

ST2, also known as IL-1 R4 and T1, is an Interleukin-1 receptor family glycoprotein that contributes to Th2 immune responses. Human ST2 consists of a 310 amino acid (aa) extracellular domain (ECD) with three Ig-like domains, a 21 aa transmembrane segment, and a 207 aa cytoplasmic domain with an intracellular TIR domain. ST2 is expressed on the surface of mast cells, activated Th2 cells, macrophages, and cardiac myocytes. It binds IL-33, a cytokine that is upregulated by inflammation or mechanical strain in smooth muscle cells, airway epithelia, keratinocytes, and cardiac fibroblasts. IL-33 binding induces the association of ST2 with IL-1R AcP, a shared signaling subunit that also associates with IL-1 RI and IL-1 R rp2. In macrophages, ST2 interferes with signaling from IL-1 RI and TLR4 by sequestering the adaptor proteins MyD88 and Mal. In addition to its role in promoting mast cell and Th2 dependent inflammation, ST2 activation enhances antigen induced hypernociception and protects from atherosclerosis and cardiac hypertrophy. Upon tissue injury, induces UCP2-dependent mitochondrial rewiring that attenuates the generation of reactive oxygen species and preserves the integrity of Krebs cycle required for persistent production of itaconate and subsequent GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 8175398458

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 57 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
DMB
Whiting, US
★★★★★ 5
Great valur
Size: 2' x 3' (Natural), Color: Gray Tipped
Soft and comfortable. Quality leather nsckrd. Genuine sheepskin. No off odors. I'm skinny and not on tailbone. Hoping this helps. The grey tipped is more of a bluish gray. Pretty but not s true gray.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2026
O
Verified Purchase
Outdoor Girl
Fort Morgan, US
★★★★★ 5
On the fence? This is the sheepskin to get!
Size: 2' x 3' (Natural), Color: Wolf Tipped
I've been reading all the reviews for sheepskins on AMZ and felt this company was the one to go for and WOW did they deliver! The sheepskin came well wrapped but not vacuum packed and is even prettier in person than the pictures. It is super soft, fluffy and dense and mine measured 26" x 40". I absolutely love the wolf tipped colors: ivory, dark grey and a slight brownish hue. There is a slight odor but I don't find it offensive. It stayed put on my leather couch and sitting on it during a Netflix movie was heavenly warm and comfortable. I did not observe any shedding. Will definitely buy another wolf tipped one, once it becomes available as it is worth the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026
T
Verified Purchase
The Marsh’s
Draper, US
★★★★★ 5
Gorgeous 😍
Size: 2' x 6' (Natural), Color: Champagne, Size: 2' x 6' (Natural), Color: Champagne
Absolutely beautiful!!! It is thick and luxurious, super soft and cozy. It’s really high quality and it shows. You can tell it’s natural without the burn test even from its cute little curls. All brushed (your pet brush is perfect 😉) out it looks stunning and fluffy. I got the champagne color and I love it! I don’t see any seams on the double pelt and it is substantial, not at all like it will disintegrate in a few years, but rather will become a much loved family heirloom. Well worth the investment! It is absolutely heavenly to perform yoga on by the fire 😌I love taking my slippers off and feeling the soft fur. I don’t want to get off it lol. I understand all those other customer’s kids and cats 🤣😂🤣
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 26, 2023
S
Verified Purchase
Sir Keith
West Palm Beach, US
★★★★★ 5
This is the one you want...
Size: 2' x 6' (Natural), Color: Natural (Yellow Undertones), Size: 2' x 6' (Natural), Color: Natural (Yellow Undertones)
I bought a ‘Genuine Sheepskin Rug Double Pelt Natural White Fur 2x6’ from Amazon in 2011 for $112.49, and recently decided to recommission it in my new living room. It looked so nice that I decided to add a second rug, and was pleased to find what Amazon claimed to be the same rug still available for only $83.78. Now I’m not one of those silly folks who expects the color and/or size of a natural product like a sheepskin rug to be perfectly predictable, and my living room is large enough that I didn’t need the two rugs to match perfectly, but when the new rug arrived, I couldn’t have been more disappointed. It was about 40% smaller than my older rug, was way, way off from anything that could be called white, and looked cheap, old, and tattered. I tried to comb it out a bit to see if I could make it look presentable, but it was a lost cause. Amazon to the rescue. I returned the rug to Amazon for a full refund the next morning, and the transaction couldn’t have been simpler. And I immediately ordered the ‘Genuine Sheepskin Rug Double Pelt Natural White Fur 2x6’ shown on this page from Super Area Rugs for $119.00. What a difference! These rugs are large, plush, and super soft. The quality of these rugs is obvious, much, much nicer that either my old sheepskin rug or the ‘bargain’ rug I returned to Amazon. I was so impressed with the quality of this rug that I immediately ordered a second, which arrived this morning (it matches the other rug perfectly). My older sheepskin has been reassigned to another room because, well, it’s not in the same league as my two new rugs, which look terrific together. As is so often the case, you get what you pay for. So if you’re looking for a top quality sheepskin rug, this is the one you want.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 23, 2015
J
Verified Purchase
Jay K
Los Angeles, US
★★★★★ 4
Very nice fleeces
This is a clean, soft, well groomed fleece intended for use on a 6 foot long sofa, so bought 2. They moved too much as a result of shifting bodies on the leather couch, so will get a longer version, sewn bottom to bottom, and used each of these fleeces on both armrests, instead.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 15, 2025

recommand products