Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 8 - Jul 13
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
LAIR1/CD305 His Tag Protein, MouseProduct Specification Species Mouse Accession Q8BG84 Amino Acid Sequence Gln22 Tyr141, with C terminal 8*His QEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTSDTSWLKTYGGGSHHHHHHHH Expression System HEK293 Molecular Weight 23 33kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4
Product Specification
| Species | Mouse |
| Accession | Q8BG84 |
| Amino Acid Sequence | Gln22-Tyr141, with C-terminal 8*His QEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTSDTSWLKTYGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 23-33kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Leukocyte-associated immunoglobulin-like receptor-1 (LAIR-1) is a type I glycoprotein of 287 amino acids containing a single extracellular Ig-like domain followed by a stalk region connected to the single transmembrane domain and 2 cytoplasmic immunoreceptor tyrosine-based inhibitory motifs that relay the inhibitory signal. LAIR-1 is expressed on almost all immune cells, including NK cells, T cells, B cells and mono-cytes, monocyte-derived dendritic cells, eosinophils, and basophils and mast cells. LAIR-1 binds both transmembrane and extracellular matrix collagens. The mLAIR-1 gene maps to the proximal end of mouse chromosome 7 in a region syntenic with human chromosome 19q13.4 where the LRC is located. LAIR-1 are involved in controlling the balance of the immune system to prevent improper activation or overactivation, which may result in tissue damage or autoimmune diseases. LAIR1 has been shown to inhibit T and NK cell activation mediated by several activating receptors. Furthermore, it has been shown that LAIR1 can deliver an inhibiting signal on intracellular free calcium concentration and immunoglobulin (Ig) production induced by the engagement of B cell antigen receptors (BCR).
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy