GABARAPL2 His Tag Protein, Human
SKU: 97418107775

GABARAPL2 His Tag Protein, Human

Sale price$182.70 Regular price$203.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GABARAPL2 His Tag Protein, HumanProduct Specification Species Human Synonyms ATG8L, ATG8C, GATE 16, GATE16, GEF 2, GEF2 Accession P60520 Amino Acid Sequence Met1 Phe117, with N terminal 8*His Tag MHHHHHHHHMKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF. Expression System E. coli Molecular Weight 17kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms ATG8L, ATG8C, GATE-16, GATE16, GEF-2, GEF2
Accession P60520
Amino Acid Sequence

Met1-Phe117, with N-terminal 8*His Tag MHHHHHHHHMKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF.

Expression System E.coli
Molecular Weight 17kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Ewing Rob M, et al. (2007) Large-scale mapping of human protein-protein interactions by mass spectrometry. Mol Syst Biol. 3(1):89. 2. Okazaki N, et al. (2000) Interaction of the Unc-51-like kinase and microtubule-associated protein light chain 3 related proteins in the brain: possible role of vesicular transport in axonal elongation. Brain Res Mol Brain Res. 85(1-2):1-12. 3. Xin Y, et al. (2001) Cloning, expression patterns, and chromosome localization of three human and two mouse homologues of GABA(A) receptor-associated protein. Genomics. 74 (3):408-13.

Background

GATE-16, also known as ATG8, belongs to the MAP1 LC3 family. It is expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. GATE-16 is expressed at very low levels in lung, thymus and small intestine. GATE-16 is involved in intra-Golgi traffic. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97418107775

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 1273 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
StellaCadente
Cuba, US
★★★★★ 5
Funny, smart and nerdy
Format: Kindle
Are you now or have you ever been a member of a TTRPG group or serious video gamer? This book is for you. You'll get all the in-jokes, understand the process and enjoy the story. It's almost literally a step-by-step description of a dungeon crawl from hell, but I was never bored. Matt Dinniman's tone and how he writes Carl are smart and enjoyable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
Z
Verified Purchase
Zuzzette Read
Boise, US
★★★★★ 4
Chaotic & absurdly funny!
Format: Paperback, Format: Paperback
Dungeon Crawler Carl was one of those books where the first thought in my head was, what on earth am I reading? And somehow that’s exactly why it works. It’s chaotic, absurdly funny, and completely outside the usual genres I gravitate toward, but it turned out to be such a fun ride. The premise alone is wild. Earth collapses into a giant dungeon run as a galactic game show, and Carl ends up fighting through it alongside his ex-girlfriend’s cat, Princess Donut, who honestly steals the show for me. Like if I ever get a cat I will probably named her Princess Donut haha! The whole thing is nonstop action, monsters, traps, loot drops, and ridiculous commentary about survival being tied to entertainment value. It’s very LitRPG, very Dungeons & Dragons energy, and packed with pop culture references. Did a hybrid read and listened to the audiobook when on the go, which is phenomenal and probably the best way to consume it. The narration makes the humor and chaos land even harder. Carl and Princess Donut as a duo are hilarious, and I can already tell this is the kind of series I’ll return to whenever I need a break from heavier reads. It’s intense, bizarre, and honestly kind of addictive, not something I would jump back to back considering there are like 9 other books, but it is a surprisingly great palate cleanser.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
D
Verified Purchase
danielle
Grantham, US
★★★★★ 5
hilarious, fun and fantastic writing
Format: Kindle
It’s been a little while since I laughed hysterically from a book. The writing, top tier, the humor immaculate and the characters, compelling. The story is a mix of satire humor and all around packed with all the things that make a book fantastic. Intrigue, mystery, actual thought. 🤣 For all my booktok girlies who are on the fence, just do it. It scratches an itch I cannot describe.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
S
Verified Purchase
Scott William Foley
Waukegan, US
★★★★★ 5
Doctor Aphra and Luke Skywalker - An Entertaining Duo!
Format: Paperback
I've greatly enjoyed the various Marvel Star Wars series, but Star Wars: Yoda's Secret War left me a little unsatisfied.  I'm very happy to say that the next installment--Screaming Citadel--righted the course and returned the series to its high standard. Of course, this volume is not just comprised of the Star Wars series.  It also has issues from Doctor Aphra.  Obviously, the two comics crossed over with each other to deliver this story as  whole. Doctor Aphra has an ancient crystal supposedly housing the sentience of a powerful Jedi.  She needs the Queen of the Screaming Citadel to access it for her, and she needs Luke Skywalker to entice the queen into doing so.  You'll have to read the book for the details on using Luke as bait.  Doctor Aphra sells it to Luke as a chance for him to encounter an actual Jedi master, and it's a chance for her to witness a remnant of the ancient past because she is an archaeologist after all, albeit a bit of an immoral one. That's a pretty good premise to achieve what this story is really all about--watching Luke and Aphra interact.  I believe Doctor Aphra is one of the greatest additions to the Star Wars universe in decades.  She first appeared in the Darth Vader series, and she won over the audience so thoroughly that she quickly earned her own title.  Honestly, though Aphra works best when pitted against the pure of heart, or at least those on the side of the Rebels.  She's Aphra, so of course she manipulates Luke, double-crosses him, saves his skin a few times, then cheats him again.  That's just who she is. It's also interesting to see a rebellious streak in Luke as he jaunts off with Aphra without telling Han, Leia, or anyone else for that matter.  We know his dad didn't always follow protocol, so these little deviations are always revealing when Luke is concerned.  It's also fun to see him beginning to realize his power.  This particular story takes place soon after A New Hope, so Luke has not yet begun to completely understand what he has at his disposal--though this book does depict Luke having some pretty cool moments with his burgeoning abilities. We also have quite a bit of Han, Leia, and another invaluable addition to the mythology named Sana Starros.  All three get their moment to shine as Han finds more and more of the hero within, Leia further establishes herself as the capable leader she is, and Sana Starros slowly reveals more and more of her past to the reader.  Guess what?  Not only does she have deep connections to Han Solo, but it's heavily hinted that she is also tied to Doctor Aphra as well.  The specifics may surprise you. And, as always, Aphra's versions of C3PO and R2D2 steal the show.  They are named 0-0-0 and BT-1.  They are basically the murderous, demented, evil version of our favorite droids, and they are forever a delight. The story of Screaming Citadel itself is entertaining.  The art is very pleasing to the eye and keeps the plot moving at a quick pace.  At times the faces of the characters based off of real life actors look almost photo realistic, which is sometimes jarring when the rest of the panel does not look so true to life.  Of course, the best quality of the book is simply seeing all of these characters play off of each other.  It's refreshing to have such rounded, charismatic new characters as Aphra, Sana, Triple-Zero, and Bee-Tee 1 making waves with our legendary favorites.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2018
C
Verified Purchase
Christian Romero
Phoenix, US
★★★★★ 4
Hokey religions and ancient weapons are no match for a good blaster at your side, kid
Format: Paperback
Star Wars: The Screaming Citadel is a crossover collection of the main Star Wars comic series and the Doctor Aphra series. The Arc revolves around the Queen of The Screaming Citadel being the only one who can open a relic containing an ancient Jedi master. Aphra then teams up with Luke Skywalker and we have our crossover event. The story itself is good. A queen with parasitic bugs controlling a planet is uncharted territory for Star Wars and it works. There were great action moments, plots painting the Empire in a morally grey light than the traditional evil one. Doctor Aphra Marvel's golden girl character was funny in this and her chemistry with Luke worked. It didn't feel forced like Marvel was trying to use the Original Characters to build-up their new ones. Where this comic fails is the inconsistent art style as this is a collection you get different art with each issue. Its starts of good and then takes a nosedive in the Aphra issue in the volume. Bad art aside Screaming Citadel was an enjoyable crossover. Doctor Aphra is the best new character to come out of this new Marvel Disney run. Screaming Citadel is worth the read it was a nice crossover that delves more into the Fantasy elements of Star Wars and works as Star Wars has been Space Wizards since 1977.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2018

recommand products