SFTPD His Tag Protein, Mouse
SKU: 98799969860

SFTPD His Tag Protein, Mouse

Sale price$182.70 Regular price$203.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

SFTPD His Tag Protein, MouseProduct Specification Species Mouse Antigen SFTPD Synonyms SP D, PSP D, SFTP4, COLEC7 Accession P50404 Amino Acid Sequence Ala20 Phe374, with C terminal 8*His

Product Specification


Species Mouse
Antigen SFTPD
Synonyms SP-D, PSP-D, SFTP4, COLEC7
Accession P50404
Amino Acid Sequence

Ala20-Phe374, with C-terminal 8*His AEMKSLSQRSVPNTCTLVMCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVGPKGENGSAGEPGPKGERGLSGPPGLPGIPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSTGAKGSTGPKGERGAPGVQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGVPGDRGIKGESGLPDSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKPFEDAQEMCKQAGGQLASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEFGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 43-50kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Kuroki Y, Voelker DR. Pulmonary surfactant proteins. J Biol Chem. 1994;269:25943–25946.
2. Sano H, Kuroki Y. The lung collectins, SP-A and SP-D, modulate pulmonary innate immunity. Mol Immunol. 2005; 42:279–287.
3. Hu F, Ding G, Zhang Z, Gatto LA, Hawgood S, Poulain FR, et al. Innate immunity of surfactant proteins A and D in urinary tract infection with uropathogenic escherichia coli. J Innate Immun. 2015; 22:9–20.
4. Liu Z, Shi Q, Liu J, Abdel-Razek O, Xu Y, Cooney RN, et al. Innate immune molecule surfactant protein d attenuates sepsis-induced acute pancreatic injury through modulating apoptosis and NF-κB-mediated Inflammation. Sci Rep. 2015; 5:17798.
5. Stahlman MT, Gray ME, Hull WM, Whitsett JA. Immunolocalization of surfactant protein-D (SP-D) in human fetal, newborn, and adult tissues. J Histochem Cytochem. 2002;50:651–660.

Background

Surfactant Protein D (SP-D, gene name: SFTPD) is a pattern recognition molecule belonging to the family of collections expressed in multiple human organ systems, including the lungs. SFTPD is located at the genomic position 10q22.2‐23.1. In addition to the respiratory system, SFTPD is also expressed in several other tissues/organs, such as the brain, pancreas, kidney, gut, endothelium, and reproductive system. SFTPD was initially identified to be expressed and secreted in lung alveolar epithelial type II cells and plays a crucial role in protecting the lung from inhaled microorganisms, organic antigens, and toxins by recruiting the innate immune system and consequently regulating inflammatory activities. SFTPD is a critical component of the innate immune system intrinsically linked to energy metabolism. SFTPD plays an important role in the innate immune system by binding bacteria, viruses, fungi, and parasites for clearance via opsonization in phagocytes, as well as aiding in the removal of allergens.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 98799969860

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 2371 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Ken
Massapequa, US
★★★★★ 5
Great pillow that helped relieve my neck pain!
This is probably one of the best, if not the best pillow I have ever used. I have periodically had a stiff neck in the mornings and the past 2 months it was constant. I got these pillows about a week ago and the first night that I tried it, my stiff neck was significantly less in the morning. I tried it for another 4 days and each day my neck felt better. I then visited my sister and used the pillow they had and the next morning my neck had pain again. The following night when I was back home, I used this pillow again and in the morning my neck pain was gone. I was completely surprised that this pillow worked for me, as I have tried many other pillows over the years. My wife, who also has neck pains, said that this pillow also helped her. The retail price is on the expensive side, but to me it is worth it. It comes with 2 queen size pillows that easily fit queen size pillow cases. It also comes with its own zippered cover that is made of a very soft microfiber type of material. The pillows are made of memory foam with portions of it more firm than others so that it can support your neck and head correctly. Depending on how you sleep, the pillow can be flipped or turned to match your sleeping style. I tend to sleep on my back and use the side that cradles your head. It is indicated by the blue portion of the pillow that I show in the pictures. The part that supports my neck is a little stiffer than where my head rests. Not sure if this works for everyone, but for me it is the best pillow I have ever tried, without a doubt!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
A
Amazon Reviewer
Alexandria, US
★★★★★ 4
Amazing Support and Sleep Quality… But the Price Is Hard to Justify
These pillows genuinely surprised me. The best way I can describe them is that they somehow feel soft and firm at the same time. The memory foam is very responsive and almost feels like slime or Play-Doh in the way you can squish and shape it, but it immediately returns back to its original form. They feel premium the moment you touch them. I usually have a slightly hard time falling asleep and tend to toss around for a while before getting comfortable, but with this pillow I fell asleep incredibly fast. I’m not exaggerating when I say it took me less than two minutes the first night I used it. That alone impressed me. The biggest difference for me has been shoulder and neck comfort. I have a weaker right shoulder, and sleeping on that side normally causes discomfort or makes me wake up in pain during the night. With this pillow, I was actually able to sleep on my right side comfortably and woke up without that usual soreness. I also noticed I slept through the night without waking up repeatedly to readjust, which is rare for me. The contour shape definitely helps with alignment. The center cradles your head nicely while the raised edges support your neck well, especially for side sleeping. I can see why some people call these orthopedic pillows. The cooling pillow covers are also really nice. They feel smooth, breathable, and cool against the skin, which made the overall sleep experience feel more comfortable and “high-end.” That said, these pillows are not for everyone. I can understand some of the other reviews mentioning that the shape can feel restrictive if you move around a lot during sleep, or if you prefer a flatter pillow. These are very specifically designed pillows, not the kind you casually fold and bunch up however you want. My only major issue is the price. The pillows themselves are genuinely excellent, but I personally cannot justify spending around $330 for two pillows. I received them through the Amazon program, and while I really do love using them, if I were paying full price with my own money, I probably would not purchase them at that cost. If the price comes down significantly, though, I could absolutely see these being worth it for people dealing with neck or shoulder pain. Overall, the comfort and support are fantastic, and they noticeably improved my sleep quality. My neck and shoulder feel much better in the mornings, which honestly matters more than fancy marketing words ever will. The pillows are great. The pricing department just seems to have taken a very confident nap.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
M
Michelle Pepe
Pawtucket, US
★★★★★ 5
The Pillow Everyone in the House Wants Now
This set was originally for my mom and my daughter, but after trying one myself, I completely understand why they like it so much. In fact, it convinced me that I need to order one for myself as well. The contour design does a great job supporting the neck and head without feeling awkward or overly firm. It feels different from a traditional pillow at first, but after a night of sleep, the extra support becomes easy to appreciate. What stood out most was how rested I felt the next morning. The pillow helped keep my head and neck in a comfortable position throughout the night, whether sleeping on my back or side. My mom immediately noticed the comfort, and my daughter took to hers right away too. It's rare to find a pillow that works well for different ages and sleep styles, but this one seems to have broad appeal. The memory foam feels supportive without being hard, and the cooling cover adds to the overall comfort. The removable cover is also convenient for keeping everything clean and fresh.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
U
User1234
Pawtucket, US
★★★★★ 3
The price of $340 for two pillows may be out of reach for many individuals
The price of $340 for two pillows may be out of reach for many individuals. While these pillows provide excellent neck support, they do limit sleeping positions to just one preferred pose. Designed with high-quality ergonomic features, these pillows are double-sided to cater to different comfort needs. The softer side is perfect for those seeking easy relaxation, while the firmer side offers enhanced support for a more restful night's sleep. Crafted from premium memory foam, the supportive contour design promotes a natural sleeping posture, ensuring balanced support whether you sleep on your back or side. Each neck pillow is accompanied by breathable, cooling pillowcases that enhance comfort throughout the night. These cases are also removable and machine washable, making it simple to keep both pillows clean, fresh, and hygienic. Overall, these pillows provide exceptional neck support, helping you relax and enjoy a restorative sleep experience.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
J
Just us …
Lowell, US
★★★★★ 5
BEST PILLOW OUT THERE! Great for back and side sleeping. So glad I found them!
Like a cloud! Really loving this pillow set! I have tried many different pillows trying to get rid of my neck pain to no avail. One of the pillows even had a chiropractor endorsing it - and then I found it was actually causing me jaw pain when I slept on my side because it was too firm and had no give. We are LOVING THIS CERVICAL NECK PILLOW! I have been using it consecutive nights as a back sleeper and side sleeper and my neck continues to feel pain-free, no cricks and when I sleep on my side there is no pressure on my jaw or shoulder pain. It has just enough support in all the right places and enough give in the center to allow my head to comfortably sink into the middle aligning my neck for comfort, and enough give it does not put pressure on my jaw from the side sleeping. It also came with 2 pillow cases that are soft - I love the way it keeps the frizzy of hair from developing around my face because my hair is sliding, rather than friction when I move in my sleep. This pillow is a Win-Win! Getting a set for my son too!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026

recommand products