LILRB2/CD85d/ILT4 His Tag Protein, Cynomolgus
SKU: 14011263247

LILRB2/CD85d/ILT4 His Tag Protein, Cynomolgus

Sale price$207.00 Regular price$230.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRB2/CD85d/ILT4 His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Accession BAE87348. 1 Amino Acid Sequence Gly24 Leu448, with C terminal 8*His

Product Specification


Species Cynomolgus
Accession BAE87348.1
Amino Acid Sequence Gly24-Leu448, with C-terminal 8*His GTLPKPMLWAEPGSMISEGSPVTLRCQGSLQVQEYRLYKGKKPASWVRRIQQELVKKGYFAIGFITWEHTGQYRCQYYSHSWWSEPSDPLELVVTGAYSKPTLSALPSPVVASGGNVSLQCDSQVTFDGFVLCKEGEDEHPQRLNSQSHARGWSWAVFSVVPVSPSRRWSYRCYGYDSHSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCGSDVGYDRFALYKEGERDFLQRPSRQPQAGLSQANFLLGPVSRSHGGQYRCSGAHNLSSEWSAPSDPLDILISGQIRGTPFLSVQPGPTVVSGENVTLLCQSSWQFHAFLLTQAGAADAHLHLRSMYKYPKYQAELSMSPVTSAHAGTYRCYGSLSSNPYLLSVPSDPLELVVSGAVDTLGLSQNNSETKTASHSQDYTVENLGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 63-70kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin (Ig)-like receptor B2 (LILRB2) is a member of leukocyte Ig-like receptors (LILRs), also known as CD85D, ILT4, LIR2, and MIR10, contains four extracellular immunoglobulin domains, a transmembrane domain, and three cytoplasmic ITIMs. It is expressed on hematopoietic stem cells, monocytes, macrophages, DCs, neutrophils, basophils, platelets, and activated CD4+T cells, as well as in vitro cultured endothelial cells, mast cell progenitors, and osteoclasts. LILRB2 plays physiological roles in multiple tissues. LILRB2 is involved in immunotolerance in pregnancy and transplantation. HLA-G/LILRB2 interactions promote accumulation and the suppressive activity of MDSCs during human pregnancies. Crosslinking of LILRB2 with Fcγ R in vitro led to inhibition of Fcγ R-mediated signaling in monocytes and serotonin release in basophilic cells. Upregulation of LILRB2 induced the tolerance of DCs. Interaction of LILRB2 with HLA class I molecules is positively associated with viral replication in HIV, suggesting that this interaction leads to a blunted immune response. Upregulation of LILRB2 and LILRB4 in antigen-presenting cells in response to Salmonella infection suggests a role for these receptors in balancing the inflammatory response against bacterial infection. LILRB2 is localized in neutrophil lipid rafts and rapidly moves to the cell surface upon neutrophil stimulation. This upregulated LILRB2 then enhances the inhibitory signals of HLAG on the phagocytic function of neutrophils. Future studies are required to shed light on how neutrophil and immune responses are modulated through LILRB2 interactions with this diverse set of ligands.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 14011263247

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 2040 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
David
Natrona Heights, US
★★★★★ 5
Exceeded expectations in every way.
Size: 2' x 3' (Sheepskin shape), Color: Gray Tip, Size: 2' x 3' (Sheepskin shape), Color: Gray Tip
I purchased a pair of these a week apart, because the price seemed too good to be true. Instead, they have exceeded my expectations. I own a Buick with leather seats that look incredible, but are not comfortable on long trips, and my wife and I were preparing to leave on a 2200 mile round trip vacation. On the first day, we drove 700 miles, much of it through desert. We were tired when we reached our destination, but comfortable and cool for every mile of it. The sheepskins have made such a difference, that I have never removed them from the car. It is now July, with triple digit temperatures every day, surrounded by desert. The sheepskin keep us cool on every drive. I could have purchased sheepskin seat covers, but these provide the same comfort for a fraction of the cost. Yes, it takes a small amount of effort to adjust them when you first get into the car, but I don't even think about it any more. As far as the quality, there is no shedding, no smell, and no discoloration. We have put over 4,000 miles on the car since I put these in, and I have no complaints to register.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 18, 2025
C
Verified Purchase
Courtney Harris
Port Orchard, US
★★★★★ 5
Just buy it!
Color: Grey, Size: 74"x60"
I'm always cold and wanted a blanky, a goto cuddly blanket! I bought this with the intentions of turning it into a duvet for my heating blanket. Now, I haven't bought a blanket in over 20yrs and then it was just some down comforters where I updated the duvets over the years but that's it. So I started shopping and picked my top 5 faux fur blankets based on fiber density (where available), color, and customer reviews. I was willing to pay as long as I got that goto blanky, I didnt want to be left underwhelmed, especially the more I have to spend. As a blanket newbie I got stuck and couldn't decide, so it came down to customer reviews and price point. There is $600 brand of blanket which im.sure is lovely but I will never know, just crossed them off my list, couldn't justify it, leaving this as the next most expensive on my list. So, I asked myself, do you really get what you pay for? Or all these blankets made by the same company, basically the same with different price tags? After reading EVERY SINGLE REVIEW ON ALL 5 BLANKETS and some others I had crossed out because I'm so terrified of buyers remorse, THIS BLANKET HAS THE FEWEST NEGATIVE COMMENTS OF ANY BLANKET!!! That being said theres a lot of postive comments out there but what if the other blankets positive comments are just from people who've never experienced a REALLY NICE BLANKY??? So I went with highest price point willing to spend (under $300ish) and fewest negative comments from people who sounded like they knew blankets, pics and videos people uploaded, etc. I let go and turned it over to the universe... If you're on the fence because it is pricey, JUST GET IT! It's freaking nice, like REALLY NICE! It's as if not more comfy than my 20 year old ralph Lauren duvet which I spent way more on than this. THIS BLANKET IS AMAZING and IT DOESNT SHED! 1. I'm not a trapper or a tanner but it looks real af to me. Real enough... 2. The fur is long, soft and fluffy! It's like your friends shaggy dog you want to love and squeeze but you know he hasn't been brushed and can smell him when you walked in the door. It's like that but only positive, I never want to leave it , pet it like dog, it's becoming my best friend, and I don't have to walk it! Even the inside is soft! It's like husky on th outside and rabbit on the inside!!! 3. It's warm and It's got some weight to it! Definitely not a cheap throw!!!!! Remember I was gonna use this as a duvet cover for my electric blanket??? Under this alone I sweat! Several times a night i wake up and throw it off me, my electric blanket doesn't even make me sweat and which is why I thought I could use cover for it.... WRONG! This blanket was all i needed! I've already probably said too much, but this Is the first review I've ever written. All I can say is if you're undecided; JUST GET THIS DANG BLANKET, SERIOUSLY! One more thing, to tell the world how crazy my fear of buyers remorse is a week or so ago, my number 3 blanket, leedy much cheper than this, was on ridiculously low sale so I had to buy it too see I you get what you pay for??? And YOU DO! Granted, It's a really nice blanket, and I probably would have been fine with it, HAVING NEVER SEEN THIS BLANKET.... The other blanket soft, shorter hair, looks real enough, sheds a bit so I brush it, but compared to this blanket, well you can't! It's like comparing a howrd Johnson or days inn to the ritz-carlton, or tube hamburger and a filet, one of these blankets you might consider cutting up for a kids costume and the other you definitely would not and its not just because of the price differnce, but in this instance, you do get what you pay for! The other blanket is not like us, hahaha If you made it this far I hope this helps you, good luck, and I'm telling you...
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 21, 2025
J
Verified Purchase
Jennifer Gutkosky
Natrona Heights, US
★★★★★ 5
Buy this while it’s priced so low.
Color: Brown, Size: 74"x60"
I am a collector of furry blankets and this one is my new favorite. It’s heavy, and really warm. It’s also a beautiful blanket with the hair tones differently than I’ve seen before. Thank you for the high quality and a relatively lower price than other of close to the same value. It’s so soft and beautiful I had to buy another one!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 30, 2025
A
Verified Purchase
Amber
Grantham, US
★★★★★ 5
Luxury blanket it's everything I expected it to be
This is a nice soft smooth blanket it feels almost like a real animal it's not super heavy but it's a good weight it has a dense short hair best for someone who doesn't want a super furry blanket it's very affordable for the quality it's very warm its shiny in the light I love it I haven't washed it but im sure it would wash easily. it seems durable doesn't feel cheap treat yourself to luxury and get this blanket
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 6, 2025
R
Verified Purchase
Rayquan Palmer
Lowell, US
★★★★★ 4
Look extremely good and very good quality feel.
Color: Brown, Size: 74"x90"
Very warm and comfortable. Moreover, feel great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2025

recommand products