ACVR2B His Tag Protein, Mouse
SKU: 35752589027

ACVR2B His Tag Protein, Mouse

Sale price$216.00 Regular price$240.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ACVR2B His Tag Protein, MouseProduct Specification Species Mouse Synonyms ACVR2B, ACTRIIB, HTX4, Activin receptor type IIB, Activin A Receptor Type 2B Accession P27040 Amino Acid Sequence Ser19 Thr134, with C terminal 8*His SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPTGGGSHHHHHHHH Expression System HEK293 Molecular Weight 25 35kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag

Product Specification


Species Mouse
Synonyms ACVR2B, ACTRIIB, HTX4, Activin receptor type IIB, Activin A Receptor Type 2B
Accession P27040
Amino Acid Sequence

Ser19-Thr134, with C-terminal 8*His SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPTGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

25-35kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Olsen O E. et al. (2020) Activins as Dual Specificity TGF-β Family Molecules: SMAD-Activation via Activin- and BMP-Type 1 Receptors. Biomolecules. 10(4): 519.

Background

Activin proteins that belong to the transforming growth factor-beta (TGF-β) superfamily, exert their biological actions by binding to heteromeric receptor complexes of type I and type II serine/threonine kinase receptors. On ligand binding, type I and II receptors form a stable complex, resulting in phosphorylation of type I receptors by type II receptors with constitutive kinase activity, and subsequently initiates the activation of downstream molecules including the endogenous Smads. ActRIIB, also known as ActRIIB, is a type II receptor containing an extracellular domain (ECD), a transmembrane segment, and a cytoplasmic region that includes the kinase domain. ActRIIB is a receptor for activin A, activin B and inhibin A. Multiple ActRIIB isoforms can also be generated, which bind activin isoforms with different affinities.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 35752589027

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 2141 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Brian M. Edwards
Bozeman, US
★★★★★ 5
Just Love this.... Read On!
Color: Silver, Memory Storage Capacity: 128 GB, Set name: Wi-Fi + Cellular
Like knew and seems to have been powered on one time only. Apple treat it as a new device. Its spotless and works great. I have had several ipad pro's and decided to by this instead and I actually prefer it. It does everything I could do with my ipad pro 2020 and then some. Its faster, good cameras. The e-sim card works great though I do wish it had a physical sim card slow.. oh well! The battery life is really excellent, it was quick to set up via a transfer from my old device. I added a case that looks like a fancy note book and love it. This helps with drops and scratches. I have not added a screen protector yet. The storage capacity is the same as my old ipad pro, I will never use 128 gb anyways... To sum up, this gets 10 out of 10... and its a great replacement for a ipad pro!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 13, 2025
L
Verified Purchase
Lola
Lake Worth, US
★★★★★ 5
Great conditions just like new
Color: Yellow, Memory Storage Capacity: 128 GB, Set name: Wi-Fi + Cellular
Hey I usually don’t leave reviews but I do feel Like this one needed one thank you for sending out the iPad well packed .. I received it in great condition it’s been working pretty good no complains I got it for my 3 year old son who’s on his third iPad lol hopefully this is his last , just like new I love it no scratches nothing literally brand new thank you
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
B
Verified Purchase
Bri
Battle Creek, US
★★★★★ 5
Good quality, good price, bad shipping tho
Color: Silver, Memory Storage Capacity: 128 GB, Set name: Wi-Fi
Honestly I was really happy with the iPad. The one I got was RENEWED in Excellent quality. I will start off by saying that it was poorly packaged during shipping and the iPad box was severely damaged, but luckily my iPad was just fine. The iPad came decently, but not fully, charged and was quick and easy to set up. The battery life does not last as long as my Galaxy Note 20 Ultra, but I am also sure I do not have it optimized for battery saving. I got this iPad for 2 reasons. 1) To be a pseduo laptop with a keyboard case for school, and 2) procreate. I am overall happy with the item. I'm just sad I found a better deal on the exact same model sold at Walmart and its in pink (;-;). The item functions well, and is as described, it was a really good deal
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 2, 2025
B
Verified Purchase
Brian B
Boise, US
★★★★★ 5
I purchased it to program Harley. Pretty nice
Color: Silver, Memory Storage Capacity: 128 GB, Set name: Wi-Fi + Cellular
I've never had an Apple product before, the charging is slow, I love it because it's very light and durable I got it on sale So the value is very good. It's very thin also which I do like that and the collars are very bright and clear... I did drop it but from a low distance in the durability is great. Never damaged it a bit
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
M
Verified Purchase
MJake
Fort Morgan, US
★★★★★ 4
Easy to use
Color: Silver, Memory Storage Capacity: 128 GB, Set name: Wi-Fi
Good product. Easy to use. The sound turns off occasionally which seems to be a glitch with ipads
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026

recommand products