Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 8 - Jul 13
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Biotinylated CD47 His&Avi Tag Protein, MouseProduct Specification Species Mouse Synonyms MER6, IAP, OA3 Accession Q61735 1 Amino Acid Sequence Gln19 Lys140, with C terminal 8*His&Avi tag QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKGGGSGGGSHHHHHHHHGLNDIFEAQKIEWHE Expression System HEK293 Molecular Weight 33 43kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Biotin Tag Avi Tag, His Tag Physical Appearance
Product Specification
| Species | Mouse |
| Synonyms | MER6, IAP, OA3 |
| Accession | Q61735-1 |
| Amino Acid Sequence | Gln19-Lys140, with C-terminal 8*His&Avi tag QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKGGGSGGGSHHHHHHHHGLNDIFEAQKIEWHE |
| Expression System | HEK293 |
| Molecular Weight | 33-43kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Biotin |
| Tag | Avi Tag, His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Brown E J. et al. (2001) Integrin-associated protein (CD47) and its ligands. Trends Cell Biol. 11(3): 130-135. 2. Oldenborg P A. (2004) Role of CD47 in erythroid cells and in autoimmunity. Leuk Lymphoma. 45(7): 1319-1327. 3. Kaczorowski D J. et al. (2007) Targeting CD47: NO limit on therapeutic potential. Circ Res. 100(5): 602-603. |
Background
CD47, also known as Integrin-associated protein (IAP), is a typical representative of the "marker of self" of targets expressed by all types of cells. CD47 is a glycoprotein with an immunoglobulin variable N-terminal domain, five transmembrane domains, and a short C-terminal intracellular tail with four variably different splicing isomers, resulting in four isoforms. CD47 is an immune cell group that plays a major role in targeted tumor immunotherapy. CD47 expressed by cancer cells interacts with SIRP-α and SIRP-γ expressed by NK cells to protect cancer cells from phagocytosis and elimination. CD47 was highly expressed in a variety of solid tumor cells and malignant hematoma cells, and its expression level was positively correlated with disease progression.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy