LILRA1 His Tag Protein, Human
SKU: 62961358853

LILRA1 His Tag Protein, Human

Sale price$324.00 Regular price$360.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRA1 His Tag Protein, HumanProduct Specification Species Human Accession O75019 1 Amino Acid Sequence Pro17 Asn461, with C terminal 8*His

Product Specification


Species Human
Accession O75019-1
Amino Acid Sequence Pro17-Asn461, with C-terminal 8*His PRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVSGAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVENGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 72-85 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin-like receptors (LILRs) are inhibitory, stimulatory or soluble receptors encoded within the leukocyte receptor complex. LILRs includes activating (LILRA1, LILRA2, LILRA3) and inhibitory (LIRB1, LILRB2, LILRB3, LILRB4, LILRB5) isoforms. LILRA1, also known as CD85i and LIR-6, is a Protein Coding gene. Among its related pathways are Innate Immune System and Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. Mature human LILRA1 consists of a 445 amino acid (aa) extracellular domain (ECD) with 4 Ig-like domains, a 21 aa transmembrane segment, and a 7 aa cytoplasmic tail. LILRA1 (LIR-6) can recognize MHC (major histocompatibility complex) class I or class I-like molecules, and high levels of sequence similarity among LILRA1, LILRA2 (ILT1), LILRA3 (ILT6) and LILRB1/B2. Among its related pathways are Innate Immune System and Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. Gene Ontology (GO) annotations related to this gene include transmembrane signaling receptor activity and antigen binding.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 62961358853

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 582 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kindle Reader
Natrona Heights, US
★★★★★ 5
Cozy, Cute, and Practical!
Size: Twin/Twin XL, Color: Light Pink
I got this pillow for my daughter to use when she heads off to college this fall, and she absolutely loves it! The light pink color is soft and calming, just what she wanted to match her dorm decor. It’s plush, supportive, and super comfortable, whether she's sitting up to read, study, or just relax. The removable, washable cover is a big plus, and the side pockets are so convenient for stashing her phone or glasses. While the pillow works great on its own, we still plan to get a detachable headboard to complement it for added support. Overall, this is a stylish and functional addition to her dorm setup, and we’re both really happy with the quality. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 19, 2025
N
Verified Purchase
NewYork2017
Grantham, US
★★★★★ 5
Nice decor for the bed
Size: Twin/Twin XL, Color: Black
Ordered this in black and it looks nice in the bed that doesn’t have a headboard . It comes nicely sealed and once you take it out you need to keep hitting both sides to fluff it up throughout the day . This is not a firm pillow , but if left alone on the bed it holds up and looks nice . Once you lay on it then it feels like an over fluffy pillow that keeps you upright in a comfortable way . There is no smell so that as a plus . Nice decor for the bed !
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 25, 2025
A
Verified Purchase
alfred montes jr.
West Palm Beach, US
★★★★★ 3
Buttons
Size: King, Color: Dark Grey
Here's what I like: Appearance. I like the color and how it looks on my bed. It looks appropriate for a king sized bed. Removable cover. It was easy to take the cover off and wash, which I appreciate because I like my bedding to smell fresh and clean. What I don't like: It is a bit softer than I would like. But I can live with it. I thought it was a foam pillow inside, not fill. Maybe my fault though for not reading description or reviews. Quality. This is the biggest issue driving the rating. I removed the over upon opening the item so I could wash it. The buttons are attached the the inside cover. When removing the outside cover, you have to unbotton them. They are not secured well at all. From what I can tell the threading goes through the inside cover through the fill to the button on the opposite side. I suspect this because 4 buttons came off when I removed the outside cover. They are very loosely secured to each other. Be gentle when removing and replacing the cover. Now I will have to thread the buttons again and secure it. Just a pain for a brand new item. Should I expect that for the cost of the item? I dunno. Could have been a higher rating, but, damn those buttons.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 21, 2025
R
Verified Purchase
Rafe Olson
Birmingham, US
★★★★★ 5
Nicer than the pictures!
I bought this for my wife for Christmas and it’s been a game changer for watching TV in bed. I was always having to double up on pillows and having to adjust them because they’re down and kinda deflate lol. The green color is super pretty too! Quality so far has been really good!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
S
Verified Purchase
Sonja Foster
Port Orchard, US
★★★★★ 5
Huge, super soft, cozy pillow!
Size: Jumbo (25-Inch), Color: Sage
This pillow is awesome! As a plus size person who can't sleep laying flat, the size and support level is perfect. This pillow is huge! The quality is very high, the stitching is precise, and the sage green material is soft and cozy. Great value for the price! I highly recommend this reading pillow!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026

recommand products