Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 7 - Jul 12
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
CLEC-1 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms C type lectin domain family 1 member A, C type lectin like receptor 1 Accession Q8NC01 Amino Acid Sequence Gln74 Asp280, with N terminal Human IgG Fc
Product Specification
| Species | Human |
| Synonyms | C-type lectin domain family 1 member A, C-type lectin-like receptor 1 |
| Accession | Q8NC01 |
| Amino Acid Sequence | Gln74-Asp280, with N-terminal Human IgG Fc PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIEGRQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD |
| Expression System | HEK293 |
| Molecular Weight | 55-65kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1.Sci Adv . 2022 Nov 16;8(46):eabo7621. Epub 2022 Nov 18. |
Background
CLEC-1 (C-type lectin-like receptor-1) is a type 2 transmembrane protein that belongs to the Dectin-1 family of C-type lectins. CLEC-1 is most highly expressed in activated dendritic cells and at lower levels in endothelial cells and monocytes. Dendritic cells (DCs) represent essential antigen-presenting cells that are critical for linking innate and adaptive immunity, and influencing T-cell responses. Studies have shown that CLEC-1 acts as an inhibitory receptor in dc, which can inhibit activation and downstream effect Th response. As a cell surface receptor, CLEC-1 may be a useful therapeutic target in the clinical regulation of t cell immune responses.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy