E-Selectin/CD62E His Tag Protein, Human
SKU: 84965120781

E-Selectin/CD62E His Tag Protein, Human

Sale price$162.00 Regular price$180.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

E-Selectin/CD62E His Tag Protein, HumanProduct Specification Species Human Antigen E Selectin CD62E Synonyms SELE, ELAM1, ESEL, LECAM2 Accession P16581 Amino Acid Sequence Trp22 Pro556, with C terminal 10*His

Product Specification


Species Human
Antigen E-Selectin/CD62E
Synonyms SELE, ELAM1, ESEL, LECAM2
Accession P16581
Amino Acid Sequence

Trp22-Pro556, with C-terminal 10*His

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight 80-92kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Evan Ales.The biology of E-selectinligands in leukemogenesis. Adv Cancer Res. 2023;157:229-250

Background

Trp22-Pro556, with C-terminal 10*His

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPGGGSGGGSHHHHHHHHHH

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 84965120781

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 2181 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
T_Mich13
San Leandro, US
★★★★★ 5
Loved it!
Format: Kindle
Who doesn’t love morally grey men obsessed with their omega who isn’t afraid to call them out on their unacceptable behavior and make them grovel? Tatum really is a survivor through and through. She is willing to do anything to get her mother the help she needs, even deal with the man her broke her heart. If you love brothers playing jokes, crazy stabby omegas and rich men being told no, you will enjoy this book. Great spice and great ending.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 5, 2025
S
Verified Purchase
Sycokittykat - Steff
Belleville, US
★★★★★ 4
Omega survival mode
Format: Kindle
Tatum is an Omega who has been suppressing herself since she had a heartbreaking fallout after her first heat. The boy she loved ghosted her after it was over.  Tatum lost her father when she was just 8 and her mother struggled to survive until Tatum got to be an adult and was unable to keep pushing. So now Tatum is being the parent and she needs a better paying job so she can afford to put her mother in a care facility until she is better. When she finds a job posting for Haze Instincts she knows they take care of their Omega staff and if she is a dancer or maybe something more she will be able to catch up on bills and get her mom taken care of.  As she is exposed to a few different irresistible Alphas she is forced to remember who she is and face everything she has been running from. Will she be able to accept all of her Omega nature, get her mother the care she needs, form a pack and let go of the past? This book was sad and sweet too. Tatum has been through so much and she doesn't know how everything fits together. As the pieces fit into the puzzle she has to choose a future even if it is scary.  I love the ladies she works with at the club. Their personalities are so fun. Also, I love a groveling Alpha. Though Mr. Brownies was a fun twist. I love that the story was comprehensive and filled in all of the missing pieces in a way that was engaging and made sense.  That epilogue was so freaking sweet and an absolutely perfect ending.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 24, 2025
R
Verified Purchase
Rose
Houston, US
★★★★★ 5
Exceptional
Format: Kindle
I was thoroughly intrigued with this book. It took me a couple of days to finish it, but I was running home from work to get back into the Haze pack. I loved this book and I can't wait for the next book from this author.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2025
B
Verified Purchase
BigSkyB
Alexandria, US
★★★★★ 3
ending was very rushed
Format: Kindle
Fun premise and start but the initial story buildup took 90% of book so the characters coming together and overcoming villain of story was literally less than 25 pages. Ending felt rushed and way less thought out than the premise. The whole mom part of the story was unnecessary and hard to follow.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2025
N
Verified Purchase
Nat Dubs
Pawtucket, US
★★★★★ 4
Solid Omegaverse!
Format: Kindle
4.5 strong stars!🌟 Overall great story solid omegaverse. I love how they’re fighting their instincts. Lots of spice, TONS of slick and heated moments. **Slight spoiler sort of** I was nervous reading this for pretty much one reason and that was the other “O” listed. I knew it wasn’t another female and I would have been happy/fine if it was but the concern lay in not knowing or being guaranteed the smexual preferences of our three alphas so realistically this gave me anxiety on how the dynamic would work. Anyone who has read omegaverse knows there’s usually one omega in each pack. My fear was the male omega connecting only with the female omega and that dynamic doesn’t wholly work for me. To me, the male omega needs the alphas as well so I was relieved with how this turned out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2025

recommand products