CD30/TNFRSF8 Fc Chimera Protein, Human
SKU: 90860642527

CD30/TNFRSF8 Fc Chimera Protein, Human

Sale price$189.00 Regular price$210.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD30/TNFRSF8 Fc Chimera Protein, HumanProduct Specification Species Human Accession P28908 Amino Acid Sequence Phe19 Lys379, with C terminal Human IgG Fc

Product Specification


Species Human
Accession P28908
Amino Acid Sequence Phe19-Lys379, with C-terminal Human IgG Fc FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 95-120kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

CD30, a 120 kDa cytokine receptor and transmem-brane glycoprotein, is a member of the tumor necrosis factor (TNF) receptor superfamily. The protein is comprised of an extracellular domain, a transmembrane region and a cytoplasmic domain. The majority of antibodies against human CD30 recognize epitopes within the extracellular domain. The soluble form of CD30 has a molecular weight (85 kDa) produced through proteolytic cleavage releasing the extracellular domain. Binding of CD30 with its receptor ligand activates TNF receptor-associated factor (TRAF)2 and TRAF5, initiating signal transduction pathways that can lead either to proliferation or apoptosis; CD30 induced apoptosis may lead to the self-regression seen in lymphomatoid papulosis lesions, whereas proliferation may result in anaplastic large-cell lymphoma (ALCL). The expression of CD30 by malignant lymphocytes affords an opportunity as a therapeutic target. Because CD30 is not found in most normal tissues outside of the immune system or on resting monocytes or lymphocytes, it provides an ideal target for immunotherapy. While it has been demonstrated that anti-CD30 antibodies alone display therapeutic efficacy, newer agents markedly enhance antibody effectiveness through their conjugation with various cytotoxic agents. Therefore, CD30 can serve both as a diagnostic marker for lymphocyte malignancies and as a target for therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90860642527

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 2109 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Steven A. Breedlove
Draper, US
★★★★★ 5
Eye-Opening and Heart-Expanding
Format: Paperback
I am incredibly grateful for this book. It gave me profound insight into essential truths of Christian faith and doctrine by allowing me to see them through a radically different lens than my internal lens. Plus, it opened me up enormously to the experience of black Americans who express the pain and challenge of life in our country thoughtfully and provocatively. I left this reading chastened, desiring more conversation, moved to listen better, and hoping to live differently.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 9, 2023
B
Verified Purchase
Bruce Hillyer
Pawtucket, US
★★★★★ 5
Best book I've read in last 10 years!
Format: Paperback
I'm absolutely blown away. I finished the book this morning. I have been recommending it to anyone and everyone who asks me "So, what you reading?". I'm known for having a book stack a mile high. I ran out of my first yellow highlighter! Profound stuff. The subtitle, How African American Literature Can Make Our Faith More Whole and Just, doesn't do the book justice. It is soooo much more. I highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2023
J
J. Brooke Chao
Massapequa, US
★★★★★ 5
A must read
Format: Paperback
This is an amazing book! The author takes the reader through several works of black literature, expounding on how each work shows us deep things about theology and faith.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 3, 2025
J
jdmangrum
Los Angeles, US
★★★★★ 5
Countee Cullen chapter
Format: Paperback
This book is a great read. I’m not even sure how to encapsulate my thoughts on it, but let me say the chapter, “Jesus,” on the poetry of Countee Cullen is brilliant and a masterclass on discipleship, suffering, identity, projecting onto Jesus. This one chapter could literally be a course in Christian discipleship handling multiple aspects of the life of faith. I feel like I’m not doing the chapter, the book, or Claude Atcho justice here, but I deeply recommend this book and urge readers to really sit with the Cullen chapter and all its implications. What a gift Claude Atcho has given us here!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 21, 2025
E
Erin Straza
Phoenix, US
★★★★★ 5
An exceptional, stunningly beautiful, and greatly needed book
Format: Paperback
Have you ever finished a book so heavy with truth and beauty and goodness that you don’t know how to sum it up? That’s where I am upon completing Claude Atcho’s Reading Black Books: How African American Literature Can Make Our Faith More Whole and Just. I’m the sort who marks up books with notes, underlining, and asterisks. Pages with ideas I want to return to get a folded corner. For this book? More pages are folded than not and a flip through the book reveals copious amounts of fuchsia markings. Full disclosure: Claude is a writer friend; we’ve chatted about faith, books, work, writing, and podcasting. I’ve been eagerly awaiting the release of his book, knowing it would be fantastic. You might think I was biased in that assumption, considering our previous connection, considering I received an ARC from Brazos Press. What I found from the first pages was even more than expected: my friend as pastor, shepherd, prophet, counselor, guide. Claude features 10 key creative African American works to cast a vision for human flourishing rooted in the power and love of God found in Jesus Christ. Just listen to this moving excerpt: “Healing is found in the constant individual and communal turn toward the tender mercies of God, who calls us to a theological remembrance: to locate our history in his, to make sense of our memory in his memory, to process our wounds in his wounds” (126). This book is beautifully written, theologically robust, and desperately needed. I cannot recommend this book highly enough. It is stunning.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2022

recommand products