Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 8 - Jul 13
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
LILRA6/CD85b/ILT8 His Tag Protein, HumanProduct Specification Species Human Accession Q6PI73 1 Amino Acid Sequence Gly24 Asn447, with C terminal 8*His
Product Specification
| Species | Human |
| Accession | Q6PI73-1 |
| Amino Acid Sequence | Gly24-Asn447, with C-terminal 8*His GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVENGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 60-7 kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
LILRA6, Leukocyte Immunoglobulin-like Receptor subfamily A, member 6, also called CD85b and ILT8.The leukocyte immunoglobulin-like receptor (LILR) multigene family is a family of paired receptors composed of inhibitory and activating forms, which are highly homologous in their extracellular regions and different in their intracellular regions. LILRA6 is the activating forms, which have two or four Ig-like domains with short cytoplasmic tail and associate with FcRγ chain containing immunoreceptor tyrosine-based activation motifs. LILRA6 (ILT8/CD85b) and LILRB3 (ILT5/CD85a) are paired receptors expressed by myelomonocytic leukocytes. LILRA6 and LILRB3 have high similarity in their extracellular domain, making them further difficult to distinguish., and mAbs generated against these receptors bind to neutrophils. In addition, LILRA6 is correlated with susceptibility to atopic dermatitis. LILRA6 on the surface of macrophages induces and regulates cytokines such as IL-4, IL-10, IL-17, TNFα and IFN-γ.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.1 ★★★★★
Based on 472 reviews
Sort
Product Reviews
★★★★★ 5
accurate scale
Color: Black
great product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
★★★★★ 5
Best Mid Priced Scale on the Market!
Color: Black, Color: Black
Hand down the best prices scale for the price. Excellent ability to precisely dial in pour overs. I’ve been waiting a long time for a scale like this to hit this price point.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
★★★★★ 5
Good
Color: Black
This food scale is accurate, easy to use, and very helpful for cooking and baking.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
★★★★★ 5
Great Scale
Size: 3 kg - Normal Size, Size: 3 kg - Normal Size
Great quality, it’s weight precision it’s great, easy to celan, the battery life it’s god, the value for money it’s god as well, and it’s the perfect size compact and functional to many coffee preparation even Chemex 8 cup size.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 18, 2025
★★★★★ 5
Accurate and easy to use
Size: 3 kg - Normal Size, Size: 3 kg - Normal Size
At the moment, I can't think of anything I dislike about this scale.
The buttons are responsive, the measurements are accurate (I checked the readings with a couple of calibration weights from a scientific scale), the displays are clear.
Operation in daily use is very simple.
1. Turn on scale
2. After self test, place carafe and filter
3. Press "T" to tare
4. Add grinds
5. Press "||>" to weigh the grinds. This automatically tares the scale again and sets the timer to standby. It also activates the coffee to water ratio display
6. Add water and the timer automatically starts so you get a precise bloom time.
The added water is weighed and displayed as you pour and the coffee to water ratio display gives you an instantaneous reading, so you can brew your perfect cup of coffee each time.
The scale has a large capacity and precise resolution so it works for single small cups to large pots.
All in all, the best scale I've tried so far and might pick up another one when they go on sale (again).
Highly recommended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 9, 2024