ALK-1/ACVRL1 His Tag Protein, Human
SKU: 23007584350

ALK-1/ACVRL1 His Tag Protein, Human

Sale price$266.40 Regular price$296.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ALK-1/ACVRL1 His Tag Protein, HumanProduct Specification Species Human Synonyms HHT, HHT2, ORW2, SKR3, TSR I Accession P37023 Amino Acid Sequence Asp22 Gln118, with C terminal 8*His DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQGGGSHHHHHHHH Expression System HEK293 Molecular Weight 22 28kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Synonyms HHT, HHT2, ORW2, SKR3, TSR-I
Accession P37023
Amino Acid Sequence

Asp22-Gln118, with C-terminal 8*His

DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 22-28kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Cindy Lora Gil. Bruno Larrivée. Alk1haploinsufficiency causes glomerular dysfunction and microalbuminuria indiabetic mice. ScientificRepoRtS (2020) 10.


Background

The Bone Morphogenetic Protein (BMP) receptor activin receptor–like kinase 1 (Alk1), which is predominantly expressed in the vascular endothelium, has been shown to play a critical role in angiogenesis. Embryos lacking Alk1 die early during embryonic development due to impaired vascular remodeling and lack of perivascular cell coverage. In renal physiology, Alk1 has been suggested to play an important role in the regulation of extracellular matrix deposition, including collagen type I and fibronectin, and Alk1 heterozygosity has been associated with increased renal fibrosis in a mouse model of obstructive nephropathy, probably due to the decrease in the Alk1/Smad1 antifibrotic/protective signaling in renal fibroblasts.


Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23007584350

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 1522 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tamiyah Thomas
Boise, US
★★★★★ 5
Dry glitter, not glue
Color: Glint Rainbow
This is dry glitter, not glitter spray. Will need glue for it to stick but it’s very pretty.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026
R
Rylie
Port Orchard, US
★★★★★ 5
Fine holographic sparkle with smooth and even application
Color: Glint Rainbow
I tested this glitter powder several times over about two weeks while using it on my hair and along the cheek area for festival style makeup looks. The shimmer particles are very fine, which helps create a smooth reflective effect rather than chunky glitter. The applicator releases a light dusting of powder, which makes it easier to control how much product is applied. I found that building it gradually works best, starting with a light layer and adding more for a stronger sparkle effect. The holographic finish reflects different tones depending on the lighting, shifting slightly between soft rainbow colors under brighter light. It looks subtle indoors but becomes more noticeable and reflective in direct lighting or outdoor settings. During wear, the glitter stayed in place for several hours with minimal fallout when applied lightly. I noticed that applying it over slightly set makeup or hair helped it adhere better and reduced loose particles. With its fine texture, controllable application, and noticeable sparkle under different lighting, it delivers a versatile glitter effect for creative makeup looks. The quantity of the spray was nice and it was durable under the sun too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
J
jsnggltt
Grantham, US
★★★★★ 3
Glitter Bomb
Color: Glint Rainbow
It gets ALL over the place and doesn’t stick all that well. Neat idea but it doesn’t work the way I would hope.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026
C
Verified Purchase
Cristen
Houston, US
★★★★★ 5
Great glitter body spray
Color: Fairy-Diamond, Color: Fairy-Diamond
So cute. Came with extra glitter, I’m assuming lipgloss you can make into glitter lipgloss, a funnel to help pour the glitter. Or re load your spray. The spray performance is nice. Might stick better with some oil before hand? But I like it so far. Worked 6 hours and still had glitter on me for my photoshoot. I sprayed perfume and then glitter. There’s no odor. The amount of quantity of glitter you get seems good for the price. Durability seems good so far but like I said may need some oil or lotion first to help it stick all day.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
D
Verified Purchase
Dawn
Port Orchard, US
★★★★★ 5
Troll glitter
Color: Brandy-Rose
Do not spray too much! This glitter is so fine that it dispenses easily from the puff part and you can easily make yourself look like Poppy the troll. We had so much fun with this for prom
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026

recommand products