
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 8 - Jul 13
For Your Every Summer RSVP, with Code: SUMMER15
Description
LILRA1 His Tag Protein, HumanProduct Specification Species Human Accession O75019 1 Amino Acid Sequence Pro17 Asn461, with C terminal 8*His
Product Specification
| Species | Human |
| Accession | O75019-1 |
| Amino Acid Sequence | Pro17-Asn461, with C-terminal 8*His PRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVSGAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVENGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 72-85 kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Leukocyte immunoglobulin-like receptors (LILRs) are inhibitory, stimulatory or soluble receptors encoded within the leukocyte receptor complex. LILRs includes activating (LILRA1, LILRA2, LILRA3) and inhibitory (LIRB1, LILRB2, LILRB3, LILRB4, LILRB5) isoforms. LILRA1, also known as CD85i and LIR-6, is a Protein Coding gene. Among its related pathways are Innate Immune System and Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. Mature human LILRA1 consists of a 445 amino acid (aa) extracellular domain (ECD) with 4 Ig-like domains, a 21 aa transmembrane segment, and a 7 aa cytoplasmic tail. LILRA1 (LIR-6) can recognize MHC (major histocompatibility complex) class I or class I-like molecules, and high levels of sequence similarity among LILRA1, LILRA2 (ILT1), LILRA3 (ILT6) and LILRB1/B2. Among its related pathways are Innate Immune System and Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. Gene Ontology (GO) annotations related to this gene include transmembrane signaling receptor activity and antigen binding.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.9 ★★★★★
Based on 1446 reviews
Sort
Product Reviews
★★★★★ 4
A very erudite validation of alternative energy healing
Format: Paperback
I have not got very far in reading since I am reading in parallel Rosalyn Bruyere's "Wheels of Light", but so far find it more accessible than Ms Brennan's first book, "Hands of Light" and this is quite natural since I am not a scientist. But I can't help feeling that in many instances of alternative healing modalities, a personal experience of a natural gift of healing is being made to appear to the general public as a complex and costly necessity for effecting the healing that is a natural propensity of one's body if not hindered by pre-conditioning. Notwithstanding this, I like this book because is speaks to a personal experience of healing energy as subtle sensation/LIGHT which I see as merely awaiting universal acknowledgment that ALL is Light, appearances to the contrary to be shattered by such acknowledgment, and all advances in science that corroborate that fact is welcome.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2013
★★★★★ 5
A great resource for those on their own healing journey and others
Format: Kindle
It is said that energy medicine is the next frontier of medicine. This book helps to explain why. Barbara has decades of experience working with physics, counseling, high sense perception, as well as watching and assisting thousands of people manage their energy field for wellness.
Her first book "Hands of Light" is more like a technical manual (and fascinating). This book is written for all of us - on our own healing journey and how we can **empower our selves in our own health and well being**. How we view and assimilate western concepts of "medicine", medication, therapy and other interactions into our own self has more to do with health than the intervention alone.
It is also a great resource for healers, psychologists, medical professionals - anyone in a service profession aimed to assist others in their health and wellness. The concepts are powerful when practiced with intention and depth of management of our own field. We can help others by simply managing our own awareness, mindfulness and field.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 5, 2013
★★★★★ 5
The perfect companion to Hands of Light
Format: Paperback
I love Barbara Brennan's first book Hands of Light, which I read waaaaay back when it first came out! Could not put it down and it was the one that got me started on spiritual path and exploring healing practices such as Reiki, Jin Shin Jyutsu, IET and all the other energy healing modalities. Now I am reading Light Emerging and as her first book is, it's so informative. This one is focusing on personal healing, healer and patient interaction, relationships and energy interaction and how to create positive patterns, and more. I would love to go to the Barbara Brennan School of Healing one day but in the meantime these books will carry me through to learning about healing and express myself in a more loving & nurturing way for myself and for others. This book & her first book are a must for anyone interested in exploring these types of therapy and discovering their own built-in ability to heal with energy. Enjoy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2014
★★★★★ 5
Well written book. The author really explains EFT Tapping well. Detailed review...
Format: Kindle
Well, I must say that before reading this book, I was a doubting Thomas about EFT Tapping. Then I looked up eBooks about controlling pain naturally and rediscovered EFT Tapping method for relieving pain, anxiety, Stress and more. While I found lots of books here on Amazon (Kindle versions), what I needed was a MANUAL for EFT Tapping....You know, a basic yet effective HOW TO (Illustrated) book.
1) This is the exact book I was looking for, a how to book. No fluff, just helpful stuff.
2) So I read this book and then I tried the tapping how to do. She explained that tapping with one hand is best, I tied it and it worked.
3) This book is more of a beginner book, a starting g point. However I did some tapping (just started), and my shoulder pain went from a 8 to a 4 after the first try.
(I think this worked for me because when I stress, my right shoulder (old injury) hurts.
This book has been both inspiring and helpful for me personally, I intend to continue to refer to this book and keep on Tapping!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 30, 2017
★★★★★ 5
Fantastic Author!
Format: Kindle
I love this Tessa Cason’s work. EFT is such a wonderful technique to work through difficult things. Tessa is so clear in her writing about what this technique is about and how it works. She gives great explanations of EFT and how it works. Makes it easy to understand and use EFT for yourself. I highly recommend her books to people who are both new and those who are experienced with EFT.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2022
recommand products
Snowcicle Oakleaf Hydrangea (HYDRANGEA QU. SNOWCICLE) - 3 gallon
79.99
Sim. Sprite Astilbe (ASTILBE SIM. SPRITE) - 1 gallon
37.99
Arbor Laundry Faucet with Pulldown Spray - Chrome 4736 Moen
141.00
RSVP 6-Function Diverter Trim - Chrome T60990-PC Brizo
29.39
Sunjoy® Mini Saffron Barberry (BERBERIS THUN. SUNJOY® MINI SAFFRON) - 1 gallon
44.99