Frizzled-5/FZD5 Fc Chimera Protein, Human
SKU: 45012498718

Frizzled-5/FZD5 Fc Chimera Protein, Human

Sale price$184.50 Regular price$205.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Frizzled-5/FZD5 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms C2orf31, Fz 5, hFz5, FzE5 Accession Q13467 Amino Acid Sequence Ala27 Pro167, with C terminal Human IgG Fc

Product Specification


Species Human
Synonyms C2orf31, Fz-5, hFz5, FzE5
Accession Q13467
Amino Acid Sequence

Ala27-Pro167, with C-terminal Human IgG Fc ASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 55-60kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Sun Y. et al. (2020) FZD5 contributes to TNBC proliferation, DNA damage repair and stemness. Cell Death and Disease. 11: 1060.1/2

Background

FZD5, a member in Frizzled family, was identified to be preferentially expressed in TNBC (triple-negative breast cancer), and associated with unfavorable prognosis. Loss and gain of function studies revealed that FZD5 contributed to TNBC cell G1/S transition, DNA replication, DNA damage repair, survival, and stemness. Mechanistically, transcription factor FOXM1, which promoted BRCA1 and BIRC5 transcription, acted as a downstream effecter of FZD5 signaling. FOXM1 overexpression in FZD5-deficient/low TNBC cells induced FZD5-associated phenotype. Finally, Wnt7B, a specific ligand for FZD5, was shown to be involved in cell proliferation, DNA damage repair, and stemness. Taken together, FZD5 is a novel target for the development of therapeutic strategies to overcome chemoresistance and prevent recurrence in TNBC.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 45012498718

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 1140 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Leo
Louisville, US
★★★★★ 4
It's a (smaller) soccer ball with nylon straps. Will no last long for aggressive chewers.
Color: Black Green, Size: 8 Inch
As the item title states, it's a soccer ball with straps. It feels like a soccer ball, but smaller and doesn't make any noises. The 8 inch size just right for my 50 lb dog. He can't get his mouth around the ball, but can bite down on the straps as we kick it around. He also plays and tosses it around by himself. It's also easy to clean. It's a good item, but suffers from two issues. 01) The nylon straps are tough, but not as durable as I though. My dog is aggressive chewer and has managed to chew them up a bit. 02) There is a nylon strap that is longer than all the others, so he tends to focus on that one. After about 15 days of playing with hit, he's managed to chew that strap up to the point that it's almost falling off. It would be nice if all the straps were the same, larger, size.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 27, 2025
D
Verified Purchase
debra
Dallas, US
★★★★★ 5
Highly recommend
Color: Black Green, Size: 8 Inch
I was skeptical that it would hold up to our aggressive chewer puppy (staffyX) - especially during teething. But it has survived past teething into adult chompers and is still fantastic! Its his favorite outside toy, especially the tags make it fun (and those have been holding up well too). If/when it fails, I'll buy another one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
A
Verified Purchase
Amazon Customer
Belleville, US
★★★★★ 3
great design, poor overall quality
Color: Black Green, Size: 8 Inch
My dog loves these balls. The "tags" are a great design. The problem I have is the quality as they aren't tough enough. He goes through them pretty quickly tearing off the tags and puncturing the ball. He doesn't get that these actually cost money! Each one also comes with a small pump, which I guess is great for a one time buy?, but man, if you don't own a pump just buy one and keep one. I have no use for several of these cheap pumps. How about offering the pump as an add-on for a dollar or two?
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
A
Verified Purchase
Amazon Customer
Los Angeles, US
★★★★★ 5
Ummmm🙄 not indestructible!
Color: Yellow Green, Size: 6 Inch, Color: Yellow Green, Size: 6 Inch
I have a Aussie doodle ( 1 1/2 yr old) so I decided to get her this one for Christmas and she loved it (she plays soccer with my grandkids-so I thought it would be a perfect gift and the colors are so cool green and yellow) however ..if your dog is like mine, she busted it within two days first tried chewing off the handles so I decided to cut the rest of them off-then proceeded to tear one of the pentagons entirely off and finally completely busted it… which made her very happy, but I was very sad!! If your dog is not a chewer and does not stop until she tears it apart, especially if it has some kind of noise maker which this does not-it’s a great ball and really well made! She loved it from the minute she got it played with it-wouldn’t let us take it away from her! It is made and looks like a real soccer ball. So I will have to keep searching for an indestructible soccer ball🙄😁
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2026
J
Verified Purchase
JODI P.
West Palm Beach, US
★★★★★ 5
My dog loves this.
Color: Black Green, Size: 6 Inch, Color: Black Green, Size: 6 Inch
I have a large Cane Corso who could obviously shred this but, she loves it. This ball is holding up really well. We use it for outside play and she loves batting it around and swinging it from the loops.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026

recommand products